Help

MRMAssayDB is targeted proteomics resource developed by the University of Victoria Genome British Columbia Proteomics Centre and maintained by McGill University.

MRMAssayDB is publicly accessible resource via the http://mrmassaydb.proteomicscentre.com

User guide

  1. Implementation
  2. Data sources
  3. Searching
  4. RESTful services
  5. Hyperlink
  6. How to reference MRMAssayDB?

Implementation

MRMAssayDB is implemented in python 2.7. The user web interface was developed in the Django 1.8.11 framework. The search engine was built with Elasticsearch.

The metadata from UniProt, KEGG, STRING, QuickGO and PDB are automatically retrieved via the corresponding API.

Data sources

MRMAssayDB is updated every quarter and currently it hosts following versions from different resources:

  • CPTAC data. Data retrieved on January 2021
  • PanoramaWeb data. Data retrieved on January 2021
  • PASSEL data. Data retrieved on January 2021
  • PeptideTracker data. Data retrieved on January 2021
  • SRMAtlas data. Data retrieved on January 2021
  • UniProtKB data. Relase 2020-06-01
  • UniProtKB ID conversion data. Relase date 2020-12-02
  • DisGeNET data. Version is 7.0, relase data 2020-01-01
  • KEGG pathway data. Relase date 2020-01-01
  • STRING data. Version is 11
  • QuickGO data. Relase data 2020-12-01
  • DrugBank data. Version is 5.1.8

  • Searching

    Basic

    The database can be searched using the 'search' field located on the homepage. Searching MRMAssayDB can be performed in a following way:

    By using a search term, like a protein name (e.g. Apolipoprotein L1), UniProtKB accession (e.g. O14791), gene name (e.g. APOL1), Subcellular location (e.g. Secreted), peptide sequence (e.g. ANLQSVPHASASR), organism name (e.g. Homo sapiens), pathway name (e.g. p53 signaling pathway), Disease-causing mutation name (e.g. Focal segmental glomerulosclerosis 4 (FSGS4)), GO ID (e.g. GO:0044267), GO term name (e.g. cellular protein metabolic process), GO term (e.g. Biological Process), or Drug ID (e.g. DB00030) or Human Assays for FDA approved Marker (e.g. Yes) in the search field, and pressing 'submit'.

    Advanced

    An advanced search option is available in order to select one or more fields to restrict the search and make it faster. The advanced search option is advice to make the search more focused and speed up the total time to report the results to the client side.

    Search results will be reported in an interactive datatable format where users can filter, sort, or download all or part of their MRMAssayDB results.

    In order to perform an advanced search users can enter the search terms, separated by a '|' or line feedback with each line having one entry (e.g. copy-paste from MS Excel column), into the specific form field. For example, search for one or more UniProtKB Accession(s) (UniProtKB Accession Number field):
    P09958|P23188

    OR simply type:
    P09958
    P23188

    Using user's own protein sequence database

    How to use this function

  • The user has the possibility to search the peptide assays in MRMAssaDB using own protein sequences. The is can be done by uploading the list of sequences in one file in the general protein (AA) FASTA format
  • Example
    			>sp|O43715|TRIA1_HUMAN TP53-regulated inhibitor of apoptosis 1 OS=Homo sapiens OX=9606 GN=TRIAP1 PE=1 SV=1
    			
    MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIE
    GLEFMGHGKEKPENSS
  • MRMAssayDB will check and report the presence of peptide assays in the user's protein sequences and report them in three categories.
  • If present and unique against the user's protein sequences-Present and unique.
  • If present but not unique against the user's sequences-Present but not unique.
  • If not present in the user's sequences-Not present (This term will only appear when user submits FASTA file with the selection of dropdown menu).
  • ideally the user should limit the search using additional search terms when using this option.

  • RESTful services

    This section describes how to programmatically access data and services from http://mrmassaydb.proteomicscentre.com.

    The base restful url for MRMAssayDB is : http://mrmassaydb.proteomicscentre.com/rest/api/

    The following multiple arguments are available in the API:
    UniProtKB Accession
    Protein
    Gene
    Organism
    SubCellular
    Peptide Sequence
    Pathway Name
    Disease Name
    Go ID
    Go Name
    Go Term
    Drug Bank
    Human Assays for FDA approved Marker

    Example:
    http://mrmassaydb.proteomicscentre.com/rest/api/?UniProtKB Accession=&Protein=&Gene=&Organism=&SubCellular=&Peptide Sequence=&Pathway Name=&Disease Name=&Go ID=&Go Name=&Go Term=&Drug Bank=&AssayFdaApproveMark=. A CSV file with the MRMAssayDB results will be returned for specified peptide sequence.
    http://mrmassaydb.proteomicscentre.com/rest/api/?Gene=APOL1|TP53&Organism=Homo sapiens. A CSV file with the MRMAssayDB results will be returned for specified Gene names and Organism name.

    Multiple search terms can be separated by a pipe, i.e. '|', into the specific search field. For example, search for one or more UniProtKB Accession(s) (UniProtKB field):
    http://mrmassaydb.proteomicscentre.com/rest/api/?UniProtKB Accession=P09958|P23188. A csv file with the MRMAssayDB results will be returned for specified UniProtKB Accession Number(s).


    This section describes how to share search results among scientific community from http://mrmassaydb.proteomicscentre.com.

    The base hyperlink URL for MRMAssayDB is: http://mrmassaydb.proteomicscentre.com/search/hyperlink/

    The following multiple arguments are available in the API:
    UniProtKB Accession
    Protein
    Gene
    Organism
    SubCellular
    Peptide Sequence
    Pathway Name
    Disease Name
    Go ID
    Go Name
    Go Term
    Drug Bank
    Human Assays for FDA approved Marker

    Example:
    http://mrmassaydb.proteomicscentre.com/search/hyperlink/?UniProtKB Accession=&Protein=&Gene=&Organism=&SubCellular=&Peptide Sequence=&Pathway Name=&Disease Name=&Go ID=&Go Name=&Go Term=&Drug Bank=&AssayFdaApproveMark=. A page with the MRMAssayDB results will be displayed for specified peptide sequence.
    http://mrmassaydb.proteomicscentre.com/search/hyperlink/?Gene=APOL1|TP53&Organism=Homo sapiens. A page with the MRMAssayDB results will be displayed for specified Gene names and Organism name.

    Multiple search terms can be separated by a pipe, i.e. '|', into the specific search field. For example, search for one or more UniProtKB Accession(s) (UniProtKB field):
    http://mrmassaydb.proteomicscentre.com/search/hyperlink/?UniProtKB Accession=P09958|P23188. A page with the MRMAssayDB results will be displayed for specified UniProtKB Accession Number(s).


    Reference

    Pallab Bhowmick, Yassene Mohammed, Christoph H Borchers (2018); MRMAssayDB: an integrated resource for validated targeted proteomics assays, Bioinformatics